PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0071ss00600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 285aa    MW: 32327.1 Da    PI: 6.9305
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0071ss00600.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.6e-151461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+ Ed++l ++++ +G g W+  +++ g++R++k+c++rw++yl
  Vang0071ss00600.1 14 KGAWTALEDKILTEYINVHGEGKWRHLPKRAGLKRCGKSCRLRWLNYL 61
                       79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.316965IPR017930Myb domain
SuperFamilySSF466891.52E-2112100IPR009057Homeodomain-like
SMARTSM007171.8E-121363IPR001005SANT/Myb domain
PfamPF002491.4E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-221568IPR009057Homeodomain-like
CDDcd001677.28E-91661No hitNo description
PROSITE profilePS5129410.09766108IPR017930Myb domain
SMARTSM007171.6E-566106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-1369108IPR009057Homeodomain-like
CDDcd001671.03E-571104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGRSPCCSKE GLNKGAWTAL EDKILTEYIN VHGEGKWRHL PKRAGLKRCG KSCRLRWLNY  60
LRPGIKRGNI TNDEEELIIR LHNLLGRLPG RTDNEIKNYW NTNIGRKLQN GTPGYSITNG  120
GARNTLNTVQ HDQNLKNQEW QYDKGSCLVQ TKATRWSKVT VSDEISHHND EDNKSNVGDH  180
SKMKAFLVSP SSESKNDPVL NFMENLEMDG SFFSELLKMD FPESSCQGNK ILEDNDNPSS  240
VEKGYLSPKS SCETTHFSWG DSLYDPNFEF LPVTTFTETG FDWL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-181210825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150420.0AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014515267.10.0PREDICTED: myb-related protein 308-like
SwissprotP200268e-52MYB1_HORVU; Myb-related protein Hv1
TrEMBLA0A0S3SZW40.0A0A0S3SZW4_PHAAN; Uncharacterized protein
STRINGGLYMA16G00931.11e-157(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.11e-53myb domain protein 7